PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_011845
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family LBD
Protein Properties Length: 179aa    MW: 19913.7 Da    PI: 6.9304
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_011845genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.71.1e-4471061100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +Ca+Ck+lrr+C+kdC++apyfp+++p+kfa+vhk+FGasn++k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q++ql+ +la+++
  DCAR_011845   7 PCASCKLLRRRCTKDCTFAPYFPSDDPHKFAIVHKVFGASNISKMLQELPIHQRADAVSSLVYEANARVRDPVYGCVGAISYLQNQVSQLQMQLAVAQ 104
                  7**********************************************************************************************999 PP

       DUF260  99 ee 100
                  +e
  DCAR_011845 105 TE 106
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.5876107IPR004883Lateral organ boundaries, LOB
PfamPF031953.8E-447104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MGTGHSPCAS CKLLRRRCTK DCTFAPYFPS DDPHKFAIVH KVFGASNISK MLQELPIHQR  60
ADAVSSLVYE ANARVRDPVY GCVGAISYLQ NQVSQLQMQL AVAQTEMLCI QMQQEQPPLL  120
PPSMEPISAH DLIGDDKSSF YSNNMMPQYL NYSSSNSTNV IHDSLKRESF FGHDMHVS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010658225.11e-92PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW39e-74LBD12_ARATH; LOB domain-containing protein 12
TrEMBLF6HCA71e-92F6HCA7_VITVI; Putative uncharacterized protein
STRINGVIT_13s0067g01880.t014e-92(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.11e-71LBD family protein